PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00011450-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family GRAS
Protein Properties Length: 812aa    MW: 91594.2 Da    PI: 5.7585
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00011450-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS376.72.9e-1154388091374
              GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                       l+ lL++cA+av+++d++ a+ +L++++++as +gd +qRla yf+ +L arl++s+ +l+ +l+   ts    +e l+a++l+  + P+ k+
  PSME_00011450-RA 438 LRALLVHCAQAVATDDTRGANDILKQIRQHASAYGDGTQRLANYFADGLVARLSGSGGRLFTTLSNGLTS---AAEILKAYQLLLVAIPYTKI 527
                       5789************************************************************999998...9******************* PP

              GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvak 184
                       s++++ q++l+ +e+++r+Hi+Df+i +G+QWp+L+q+LasRp+gpp+lRiTg++ p++g   +e++eetg+rLa++A+++gvpfe+++ +a 
  PSME_00011450-RA 528 SYFLTKQTVLNVTEKSNRLHIVDFGILYGFQWPSLIQSLASRPGGPPMLRITGIDFPQPGfrAAERIEETGRRLADYAKSFGVPFEYHA-IAA 619
                       ***********************************************************9*9***************************.799 PP

              GRAS 185 rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpr 277
                       ++e+l++eeL+++++E+l+Vn++++  +llde+v les+++ vL+ ++s++P+v+++   +  +n++ F +rf eal +ysalfd++e+ +pr
  PSME_00011450-RA 620 KWENLDVEELSLRSDEVLVVNCMYRFNNLLDENVVLESPKNIVLNKIRSMNPRVFIHGVVNGAYNAPFFITRFREALFHYSALFDAIETIVPR 712
                       ********************************************************************************************* PP

              GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsv 370
                       e+ +r  +E+ellgrei nvvaceg er+er et+++W+ r ++aGF ++pl+  + +q +  ++ +  + +rv+e+ ++++ gWk+r   +v
  PSME_00011450-RA 713 EHPQRLLLEKELLGREILNVVACEGLERVERPETYKQWQVRTQRAGFVQLPLDRAIFSQTRDKVKSFFHKDFRVDEDGKWILYGWKGRISNAV 805
                       ********************************************************************888******************9999 PP

              GRAS 371 SaWr 374
                         Wr
  PSME_00011450-RA 806 ATWR 809
                       9998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098569.394412789IPR005202Transcription factor GRAS
PfamPF035141.0E-112438809IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 812 aa     Download sequence    Send to blast
MADEKTGIFH SNNINVVSNN IRLQRPWLQQ GTAMPATQFR GSERPWLQQG TAIPATQFRG  60
SERPAMPATQ FRGFQPPMPD EKTGIFYSNN INGVSNNIWL QRPWLQQETA MPATQFRGSL  120
SSEKSITISD EESEDTEVYS DIVLKYISDM LMDENMDEKK CMYQECSALQ ATVKPFYDIL  180
GENYPPQGLC NSNTVGENQK QSLNYYEDDV QNKIEDSSWI GDFFNSQMPG AFESPLSPNL  240
SARYSSQYSF SYSGSSTVID GLPGSPTYEP SLSESKQGLE VGELEEDIQV APKQNFEPGV  300
ENRCHFRAPK KVSDPDPDLQ LGKREDAIFG VGVAFQMNAS HSEDENGPKR QKDPHRGDLD  360
LEDRDSNKLS AVYPDNVIRN ESFDKVLLCT ENGRVFLDVQ LEILQNGVQK SVQSGFVKGL  420
QGSKARGRKQ EKRAVVDLRA LLVHCAQAVA TDDTRGANDI LKQIRQHASA YGDGTQRLAN  480
YFADGLVARL SGSGGRLFTT LSNGLTSAAE ILKAYQLLLV AIPYTKISYF LTKQTVLNVT  540
EKSNRLHIVD FGILYGFQWP SLIQSLASRP GGPPMLRITG IDFPQPGFRA AERIEETGRR  600
LADYAKSFGV PFEYHAIAAK WENLDVEELS LRSDEVLVVN CMYRFNNLLD ENVVLESPKN  660
IVLNKIRSMN PRVFIHGVVN GAYNAPFFIT RFREALFHYS ALFDAIETIV PREHPQRLLL  720
EKELLGREIL NVVACEGLER VERPETYKQW QVRTQRAGFV QLPLDRAIFS QTRDKVKSFF  780
HKDFRVDEDG KWILYGWKGR ISNAVATWRP ST
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-504428098375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010937596.10.0PREDICTED: scarecrow-like protein 9
RefseqXP_010937597.10.0PREDICTED: scarecrow-like protein 9
TrEMBLA3E2G20.0A3E2G2_PINRA; SCARECROW-like protein 1
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-162GRAS family protein